From 991d657e4c980e6d1114e4adb27f20332e1f7d6b Mon Sep 17 00:00:00 2001 From: Mitja Felicijan Date: Tue, 28 Jun 2022 19:02:56 +0200 Subject: Added new styles --- Makefile | 17 ++++++---------- assets/general/favicon.ico | Bin 0 -> 15406 bytes ...01-03-encoding-binary-data-into-dna-sequence.md | 4 ++-- template/_meta.html | 5 +++-- template/post.html | 9 ++++++--- template/style.css | 22 +++++++++++++++------ 6 files changed, 33 insertions(+), 24 deletions(-) create mode 100644 assets/general/favicon.ico diff --git a/Makefile b/Makefile index 6e9acf0..d6b6c09 100644 --- a/Makefile +++ b/Makefile @@ -11,29 +11,24 @@ dither: bash tools/dither-images.sh openring: - openring -l 165 -n 4 -p 1 \ - -s https://cronokirby.com/posts/index.xml \ + mkdir -p public + openring -l 165 -n 5 -p 1 \ -s https://drewdevault.com/feed.xml \ -s https://danluu.com/atom.xml \ -s https://serokell.io/blog.rss.xml \ + -s https://cronokirby.com/posts/index.xml \ + -s https://www.jeffgeerling.com/blog.xml \ < template/openring.tmpl \ > template/openring-build.html dev: alternator server alternator: openring + mkdir -p public alternator --watch -build: +build: openring mkdir -p public - openring -l 165 -n 4 -p 1 \ - -s https://cronokirby.com/posts/index.xml \ - -s https://drewdevault.com/feed.xml \ - -s https://danluu.com/atom.xml \ - -s https://serokell.io/blog.rss.xml \ - < template/openring.tmpl \ - > template/openring-build.html - alternator --build rm template/openring-build.html diff --git a/assets/general/favicon.ico b/assets/general/favicon.ico new file mode 100644 index 0000000..c6b2ff4 Binary files /dev/null and b/assets/general/favicon.ico differ diff --git a/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md b/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md index fdbdf5b..4910bb3 100644 --- a/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md +++ b/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md @@ -147,7 +147,7 @@ In bioinformatics, FASTA format is a text-based format for representing either n The first line in a FASTA file started either with a ">" (greater-than) symbol or, less frequently, a ";" (semicolon) was taken as a comment. Subsequent lines starting with a semicolon would be ignored by software. Since the only comment used was the first, it quickly became used to hold a summary description of the sequence, often starting with a unique library accession number, and with time it has become commonplace to always use ">" for the first line and to not use ";" comments (which would otherwise be ignored). -```text +``` ;LCBO - Prolactin precursor - Bovine ; a sample sequence in FASTA format MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSS @@ -220,7 +220,7 @@ First we encode text file into FASTA file. Output of `quote.fa` file contains the encoded DNA sequence in ASCII format. -```text +``` >SEQ1 GACAGCTTGTGTACAAGTGTGCTTGCTCGCGAGCGGGTACGCGCGTGGGCTAACAAGTGA GCCAGCAGGTGAACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGCTGGCGGGTGA diff --git a/template/_meta.html b/template/_meta.html index 23275a0..73a33d0 100755 --- a/template/_meta.html +++ b/template/_meta.html @@ -5,10 +5,11 @@ - + - + + diff --git a/template/post.html b/template/post.html index 839444d..461480d 100755 --- a/template/post.html +++ b/template/post.html @@ -19,7 +19,7 @@

{{.Title}}

{{if .Listing}} - + {{end}}
@@ -31,11 +31,13 @@
-

- IRC: You can contact me on IRC irc.libera.chat:6697 on channel #mitjafelicijan. +

+ Comment, contact: You can contact me on IRC irc.libera.chat:6697 on channel #mitjafelicijan. Or by going to https://web.libera.chat/#mitjafelicijan.

+

You can also just write me an email at m@mitjafelicijan.com

+
{{if .Posts}} @@ -59,6 +61,7 @@
{{template "openring-build.html"}} + {{end}} diff --git a/template/style.css b/template/style.css index 0aae48b..e24f25f 100755 --- a/template/style.css +++ b/template/style.css @@ -1,3 +1,5 @@ +@import url('https://fonts.googleapis.com/css2?family=IBM+Plex+Sans:wght@300;400;500;600;700&display=swap'); + :root { --base-document-width: 640px; --base-font-size: 16px; @@ -25,7 +27,8 @@ body { background: white; - font-family: 'Times New Roman', Times, serif; + /*font-family: 'Times New Roman', Times, serif;*/ + font-family: 'IBM Plex Sans', sans-serif; color: var(--base-color); font-size: var(--base-font-size); line-height: var(--base-line-heigh); @@ -59,9 +62,13 @@ hr { /* links */ -a {} +a { + color: black; +} -a:hover {} +a:hover { + background: rgb(255, 241, 177); +} /* headings */ @@ -182,16 +189,18 @@ blockquote p { font-size: 80%; font-weight: 500; line-height: 1.2em; + color: #a7a7a7; } .post-list li a { display: inline-block; + text-decoration: none; } .post-list li a:hover {} .post-list li a h2 { - font-weight: 500; + font-weight: 400; font-size: 100%; margin: 0; } @@ -392,11 +401,12 @@ audio { .navigation header { display: block; } .navigation header h3 { text-align: center; margin-bottom: 10px; } .navigation header nav { text-align: center; } + .post-list li a h2 { font-weight: 500; } } /* light/dark mode */ -@media (prefers-color-scheme: light) { } +/*@media (prefers-color-scheme: light) { } @media (prefers-color-scheme: dark) { body { @@ -419,4 +429,4 @@ audio { blockquote:before { background-image: url('/assets/general/alert-dark.svg'); } -} +}*/ -- cgit v1.2.3