From 3e50d7f7bff5980754a34d803733306b2c9e5a63 Mon Sep 17 00:00:00 2001 From: Mitja Felicijan Date: Thu, 10 Jan 2019 02:28:42 +0100 Subject: new post --- ...01-03-encoding-binary-data-into-dna-sequence.md | 354 +++++++++++++++++++++ 1 file changed, 354 insertions(+) create mode 100644 _posts/2019-01-03-encoding-binary-data-into-dna-sequence.md (limited to '_posts/2019-01-03-encoding-binary-data-into-dna-sequence.md') diff --git a/_posts/2019-01-03-encoding-binary-data-into-dna-sequence.md b/_posts/2019-01-03-encoding-binary-data-into-dna-sequence.md new file mode 100644 index 0000000..b9a5754 --- /dev/null +++ b/_posts/2019-01-03-encoding-binary-data-into-dna-sequence.md @@ -0,0 +1,354 @@ +--- + +layout: post +title: Encoding binary data into DNA sequence +description: ok + +--- + +**Table of contents** + +1. [Initial thoughts](#initial-thoughts) +2. [Glossary](#glossary) +3. [Data encoding](#data-encoding) +4. [Quick history of DNA](#quick-history-of-dna) +5. [What is DNA?](#what-is-dna) +6. [Encode binary data into DNA sequence](#encode-binary-data-into-dna-sequence) + 1. [Basic Encoding](#basic-encoding) + 2. [FASTA file format](#fasta-file-format) + 3. [PNG encoded DNA sequence](#png-encoded-dna-sequence) +7. [Encoding text file in practice](#encoding-text-file-in-practice) +8. [Toolkit for encoding data](#toolkit-for-encoding-data) + 1. [dnae-encode](#dnae-encode) + 2. [dnae-png](#dnae-png) +9. [Benchmarks](#benchmarks) +10. [References](#references) + +## Initial thoughts + +Imagine a world where you could go outside and take a leaf from a tree and put it through your personal DNA sequencer and get data like music, videos or computer programs from it. Well, this is all possible now. It was not done on a large scale because it is quite expensive to create DNA strands but it's possible. + +Encoding data into DNA sequence is relatively simple process once you understand the relationship between binary data and nucleotides and scientists have been making large leaps in this field in order to provide viable long-term storage solution for our data that would potentially survive our specie if case of global disaster. We could imprint all the world's knowledge into plants and ensure the survival of our knowledge. + +More optimistic usage for this technology would be easier storage of ever growing data we produce every day. Once machines for sequencing DNA become fast enough and cheaper this could mean the next evolution of storing data and abandoning classical hard and solid state drives in data warehouses. + +As we currently stand this is still not viable but it is quite an amazing and cool technology. + +My interests in this field are purely in encoding processes and experimental testing mainly because I don't have the access to this expensive machines. My initial goal was to create a toolkit that can be used by everybody to encode their data into a proper DNA sequence. + +## Glossary + +**deoxyribose** +: A five-carbon sugar molecule with a hydrogen atom rather than a hydroxyl group in the 2′ position; the sugar component of DNA nucleotides. + +**double helix** +: The molecular shape of DNA in which two strands of nucleotides wind around each other in a spiral shape. + +**nitrogenous base** +: A nitrogen-containing molecule that acts as a base; often referring to one of the purine or pyrimidine components of nucleic acids. + +**phosphate group** +: A molecular group consisting of a central phosphorus atom bound to four oxygen atoms. + +**RGB** +: The RGB color model is an additive color model in which red, green and blue light are added together in various ways to reproduce a broad array of colors. + +**GCC** +: The GNU Compiler Collection is a compiler system produced by the GNU Project supporting various programming languages. + +## Data encoding + +**TL;DR:** Encoding involves the use of a code to change original data into a form that can be used by an external process [^1]. + +Encoding is the process of converting data into a format required for a number of information processing needs, including: + +- Program compiling and execution +- Data transmission, storage and compression/decompression +- Application data processing, such as file conversion + +Encoding can have two meanings[^1]: + +- In computer technology, encoding is the process of applying a specific code, such as letters, symbols and numbers, to data for conversion into an equivalent cipher. +- In electronics, encoding refers to analog to digital conversion. + +## Quick history of DNA + +- **1869** - Friedrich Miescher identifies "nuclein". +- **1900s** - The Eugenics Movement. +- **1900** – Mendel's theories are rediscovered by researchers. +- **1944** - Oswald Avery identifies DNA as the 'transforming principle'. +- **1952** - Rosalind Franklin photographs crystallized DNA fibres. +- **1953** - James Watson and Francis Crick discover the double helix structure of DNA. +- **1965** - Marshall Nirenberg is the first person to sequence the bases in each codon. +- **1983** - Huntington's disease is the first mapped genetic disease. +- **1990** - The Human Genome Project begins. +- **1995** - Haemophilus Influenzae is the first bacterium genome sequenced. +- **1996** - Dolly the sheep is cloned. +- **1999** - First human chromosome is decoded. +- **2000** – Genetic code of the fruit fly is decoded. +- **2002** – Mouse is the first mammal to have its genome decoded. +- **2003** – The Human Genome Project is completed. +- **2013** – DNA Worldwide and Eurofins Forensic discover identical twins have differences in their genetic makeup [^2]. + +## What is DNA? + +Deoxyribonucleic acid, a self-replicating material which is **present in nearly all living organisms** as the main constituent of chromosomes. It is the **carrier of genetic information**. + +> The nitrogen in our DNA, the calcium in our teeth, the iron in our blood, the carbon in our apple pies were made in the interiors of collapsing stars. We are made of starstuff. +> +> **-- Carl Sagan, Cosmos** + +The nucleotide in DNA consists of a sugar (deoxyribose), one of four bases (cytosine (C), thymine (T), adenine (A), guanine (G)), and a phosphate. Cytosine and thymine are pyrimidine bases, while adenine and guanine are purine bases. The sugar and the base together are called a nucleoside. + +![DNA](/files/dna-sequence/dna-basics.jpg#center) + +*DNA (a) forms a double stranded helix, and (b) adenine pairs with thymine and cytosine pairs with guanine. (credit a: modification of work by Jerome Walker, Dennis Myts) [^3]* + +## Encode binary data into DNA sequence + +As an input file you can use any file you want: +- ASCII files, +- Compiled programs, +- Multimedia files (MP3, MP4, MVK, etc), +- Images, +- Database files, +- etc. + +Note: If you would copy all the bytes from RAM to file or pipe data to file you could encode also this data as long as you provide file pointer to the encoder. + +### Basic Encoding + +As already mentioned, the Basic Encoding is based on a simple mapping. Since DNA is composed of 4 nucleotides (Adenine, Cytosine, Guanine, Thymine; usually referred using the first letter). Using this technique we can encode + +$$ log_2(4) = log_2(2^2) = 2 bits $$ + +using a single nucleotide. In this way, we are able to use the 4 bases that compose the DNA strand to encode each byte of data. [^4] + +| Two bits | Nucleotides | +| -------- | ---------------- | +| 00 | **A** (Adenine) | +| 10 | **G** (Guanine) | +| 01 | **C** (Cytosine) | +| 11 | **T** (Thymine) | + +With this in mind we can simply encode any data by using two-bit to Nucleotides conversion + +```pascal +{ Algorithm 1: Naive byte array to DNA encode } +procedure EncodeToDNASequence(f) string +begin + enc string + while not eof(f) do + c byte := buffer[0] { Read 1 byte from buffer } + bin integer := sprintf('08b', c) { Convert to string binary } + for e in range[0, 2, 4, 6] do + if e[0] == 48 and e[1] == 48 then { 0x00 - A (Adenine) } + enc += 'A' + else if e[0] == 48 and e[1] == 49 then { 0x01 - G (Guanine) } + enc += 'G' + else if e[0] == 49 and e[1] == 48 then { 0x10 - C (Cytosine) } + enc += 'C' + else if e[0] == 49 and e[1] == 49 then { 0x11 - T (Thymine) } + enc += 'T' + return enc { Return DNA sequence } +end +``` + +Another encoding would be **Goldman encoding**. Using this encoding helps with Nonsense mutation (amino acids replaced by a stop codon) that occurs and is the most problematic during translation because it leads to truncated amino acid sequences, which in turn results in truncated proteins. [^4] + +[Where to store big data? In DNA: Nick Goldman at TEDxPrague](https://www.youtube.com/watch?v=a4PiGWNsIEU) + +### FASTA file format + +In bioinformatics, FASTA format is a text-based format for representing either nucleotide sequences or peptide sequences, in which nucleotides or amino acids are represented using single-letter codes. The format also allows for sequence names and comments to precede the sequences. The format originates from the FASTA software package, but has now become a standard in the field of bioinformatics. [^5] + +The first line in a FASTA file started either with a ">" (greater-than) symbol or, less frequently, a ";" (semicolon) was taken as a comment. Subsequent lines starting with a semicolon would be ignored by software. Since the only comment used was the first, it quickly became used to hold a summary description of the sequence, often starting with a unique library accession number, and with time it has become commonplace to always use ">" for the first line and to not use ";" comments (which would otherwise be ignored). + +``` +;LCBO - Prolactin precursor - Bovine +; a sample sequence in FASTA format +MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSS +EMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHL +VTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDED +ARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC* + +>MCHU - Calmodulin - Human, rabbit, bovine, rat, and chicken +ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID +FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREA +DIDGDGQVNYEEFVQMMTAK* + +>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus] +LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV +EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG +LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL +GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX +IENY +``` + +FASTA format was extended by [FASTQ](https://en.wikipedia.org/wiki/FASTQ_format) format from the [Sanger Centre](https://www.sanger.ac.uk/) in Cambridge. + +### PNG encoded DNA sequence + +| Nucleotides | RGB | Color | +| ------------ | ----------- | ------ | +| A (Adenine) | (0,0,255) | Blue | +| G (Guanine) | (0,100,0) | Green | +| C (Cytosine) | (255,0,0) | Red | +| T (Thymine) | (255,255,0) | Yellow | + +## Encoding text file in practice + +In this example we will take a simple text file as our input stream for encoding. This file will have a quote from Niels Bohr and saved as txt file. + +> How wonderful that we have met with a paradox. Now we have some hope of making > progress. +> ― Niels Bohr + +First we encode text file into FASTA file. + +```bash +./dnae-encode -i quote.txt -o quote.fa +2019/01/10 00:38:29 Gathering input file stats +2019/01/10 00:38:29 Starting encoding ... + 106 B / 106 B [==================================] 100.00% 0s +2019/01/10 00:38:29 Saving to FASTA file ... +2019/01/10 00:38:29 Output FASTA file length is 438 B +2019/01/10 00:38:29 Process took 987.263µs +2019/01/10 00:38:29 Done ... +``` + +Output of `quote.fa` file contains the encoded DNA sequence in ASCII format. + +``` +>SEQ1 +GACAGCTTGTGTACAAGTGTGCTTGCTCGCGAGCGGGTACGCGCGTGGGCTAACAAGTGA +GCCAGCAGGTGAACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGCTGGCGGGTGA +ACAAGTGTGCCGGTGAGCCAACAAGCAGACAAGTAAGCAGGTACGCAGGCGAGCTTGTCA +ACTCACAAGATCGCTTGTGTACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGTAT +GCTTGCTGGCGGACAAGCCAGCTTGTAAGCGGACAAGCTTGCGCACAAGCTGGCAGGCCT +GCCGGCTCGCGTACAAATTCACAAGTAAGTACGCTTGCGTGTACGCGGGTATGTATACTC +AACCTCACCAAACGGGACAAGATCGCCGGCGGGCTAGTATACAAGAACGCTTGCCAGTAC +AACC +``` + +Then we encode FASTA file from previous operation to encode this data into PNG. + +```bash +./dnae-png -i quote.fa -o quote.png +2019/01/10 00:40:09 Gathering input file stats ... +2019/01/10 00:40:09 Deconstructing FASTA file ... +2019/01/10 00:40:09 Compositing image file ... + 424 / 424 [==================================] 100.00% 0s +2019/01/10 00:40:09 Saving output file ... +2019/01/10 00:40:09 Output image file length is 1.1 kB +2019/01/10 00:40:09 Process took 19.036117ms +2019/01/10 00:40:09 Done ... +``` + +After encoding into PNG format this file looks like this. + +![Encoded Quote in PNG format](/files/dna-sequence/quote.png) + +The larger the input stream is the larger the PNG file would be. + +Compiled basic Hello World C program with [GCC](https://www.gnu.org/software/gcc/) would [look like](/files/dna-sequence/sample.png). + +```c +// gcc -O3 -o sample sample.c +#include + +main() { + printf("Hello, world!\n"); + return 0; +} +``` + +## Toolkit for encoding data + +I have created a toolkit with two main programs: +- dnae-encode (encodes file into FASTA file) +- dnae-png (encodes FASTA file into PNG) + +Toolkit with full source code is available on [github.com/mitjafelicijan/dna-encoding](https://github.com/mitjafelicijan/dna-encoding). + +### dnae-encode + +```bash +> ./dnae-encode --help +usage: dnae-encode --input=INPUT [] + +A command-line application that encodes file into DNA sequence. + +Flags: + --help Show context-sensitive help (also try --help-long and --help-man). + -i, --input=INPUT Input file (ASCII or binary) which will be encoded into DNA sequence. + -o, --output="out.fa" Output file which stores DNA sequence in FASTA format. + -s, --sequence=SEQ1 The description line (defline) or header/identifier line, gives a name and/or a unique identifier for the sequence. + -c, --columns=60 Row characters length (no more than 120 characters). Devices preallocate fixed line sizes in software. + --version Show application version. +``` + +### dnae-png + +```bash +> ./dnae-png --help +usage: dnae-png --input=INPUT [] + +A command-line application that encodes FASTA file into PNG image. + +Flags: + --help Show context-sensitive help (also try --help-long and --help-man). + -i, --input=INPUT Input FASTA file which will be encoded into PNG image. + -o, --output="out.png" Output file in PNG format that represents DNA sequence in graphical way. + -s, --size=10 Size of pairings of DNA bases on image in pixels (lower resolution lower file size). + --version Show application version. +``` + +## Benchmarks + +First we generate some binary sample data with dd. + +```bash +dd if=<(openssl enc -aes-256-ctr -pass pass:"$(dd if=/dev/urandom bs=128 count=1 2>/dev/null | base64)" -nosalt < /dev/zero) of=1KB.bin bs=1KB count=1 iflag=fullblock +``` + +Our freshly generated 1KB file looks something like this (its full of garbage data as intended). + +![Sample binary file 1KB](/files/dna-sequence/sample-binary-file.png) + +We create following binary files: +- 1KB +- 10KB +- 100KB +- 1MB +- 10MB +- 100MB + +After this we create FASTA files for all the binary files by encoding them into DNA sequence. + +```bash +./dnae-encode -i 100MB.bin -o 100MB.fa +``` + +Then we GZIP all the FASTA files to see how much the can be compressed. + +```bash +gzip -9 < 10MB.fa > 10MB.fa.gz +``` + +**Speed of encoding binary file into FASTA format.** + +![Chart: encoding speed](/files/dna-sequence/chart-encoding-speed.png) + +**File sizes of encoded files and also GZIP-ed variations.** + +![Chart: file sizes](/files/dna-sequence/chart-file-sizes.png) + +[Download ODS file with benchmarks.](/files/dna-sequence/benchmarks.ods). + +## References + +[^1]: https://www.techopedia.com/definition/948/encoding +[^2]: https://www.dna-worldwide.com/resource/160/history-dna-timeline +[^3]: https://opentextbc.ca/biology/chapter/9-1-the-structure-of-dna/ +[^4]: https://arxiv.org/abs/1801.04774 +[^5]: https://en.wikipedia.org/wiki/FASTA_format -- cgit v1.2.3