From 991d657e4c980e6d1114e4adb27f20332e1f7d6b Mon Sep 17 00:00:00 2001 From: Mitja Felicijan Date: Tue, 28 Jun 2022 19:02:56 +0200 Subject: Added new styles --- posts/2019-01-03-encoding-binary-data-into-dna-sequence.md | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) (limited to 'posts/2019-01-03-encoding-binary-data-into-dna-sequence.md') diff --git a/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md b/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md index fdbdf5b..4910bb3 100644 --- a/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md +++ b/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md @@ -147,7 +147,7 @@ In bioinformatics, FASTA format is a text-based format for representing either n The first line in a FASTA file started either with a ">" (greater-than) symbol or, less frequently, a ";" (semicolon) was taken as a comment. Subsequent lines starting with a semicolon would be ignored by software. Since the only comment used was the first, it quickly became used to hold a summary description of the sequence, often starting with a unique library accession number, and with time it has become commonplace to always use ">" for the first line and to not use ";" comments (which would otherwise be ignored). -```text +``` ;LCBO - Prolactin precursor - Bovine ; a sample sequence in FASTA format MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSS @@ -220,7 +220,7 @@ First we encode text file into FASTA file. Output of `quote.fa` file contains the encoded DNA sequence in ASCII format. -```text +``` >SEQ1 GACAGCTTGTGTACAAGTGTGCTTGCTCGCGAGCGGGTACGCGCGTGGGCTAACAAGTGA GCCAGCAGGTGAACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGCTGGCGGGTGA -- cgit v1.2.3