diff options
Diffstat (limited to 'posts')
| -rw-r--r-- | posts/2019-01-03-encoding-binary-data-into-dna-sequence.md | 4 |
1 files changed, 2 insertions, 2 deletions
diff --git a/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md b/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md index fdbdf5b..4910bb3 100644 --- a/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md +++ b/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md | |||
| @@ -147,7 +147,7 @@ In bioinformatics, FASTA format is a text-based format for representing either n | |||
| 147 | 147 | ||
| 148 | The first line in a FASTA file started either with a ">" (greater-than) symbol or, less frequently, a ";" (semicolon) was taken as a comment. Subsequent lines starting with a semicolon would be ignored by software. Since the only comment used was the first, it quickly became used to hold a summary description of the sequence, often starting with a unique library accession number, and with time it has become commonplace to always use ">" for the first line and to not use ";" comments (which would otherwise be ignored). | 148 | The first line in a FASTA file started either with a ">" (greater-than) symbol or, less frequently, a ";" (semicolon) was taken as a comment. Subsequent lines starting with a semicolon would be ignored by software. Since the only comment used was the first, it quickly became used to hold a summary description of the sequence, often starting with a unique library accession number, and with time it has become commonplace to always use ">" for the first line and to not use ";" comments (which would otherwise be ignored). |
| 149 | 149 | ||
| 150 | ```text | 150 | ``` |
| 151 | ;LCBO - Prolactin precursor - Bovine | 151 | ;LCBO - Prolactin precursor - Bovine |
| 152 | ; a sample sequence in FASTA format | 152 | ; a sample sequence in FASTA format |
| 153 | MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSS | 153 | MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSS |
| @@ -220,7 +220,7 @@ First we encode text file into FASTA file. | |||
| 220 | 220 | ||
| 221 | Output of `quote.fa` file contains the encoded DNA sequence in ASCII format. | 221 | Output of `quote.fa` file contains the encoded DNA sequence in ASCII format. |
| 222 | 222 | ||
| 223 | ```text | 223 | ``` |
| 224 | >SEQ1 | 224 | >SEQ1 |
| 225 | GACAGCTTGTGTACAAGTGTGCTTGCTCGCGAGCGGGTACGCGCGTGGGCTAACAAGTGA | 225 | GACAGCTTGTGTACAAGTGTGCTTGCTCGCGAGCGGGTACGCGCGTGGGCTAACAAGTGA |
| 226 | GCCAGCAGGTGAACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGCTGGCGGGTGA | 226 | GCCAGCAGGTGAACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGCTGGCGGGTGA |
