diff options
| author | Mitja Felicijan <mitja.felicijan@gmail.com> | 2023-10-31 08:38:25 +0100 |
|---|---|---|
| committer | Mitja Felicijan <mitja.felicijan@gmail.com> | 2023-10-31 08:38:25 +0100 |
| commit | f59672679db271f6b24a41e215401ab5001ecd96 (patch) | |
| tree | 367e04e449d8b02266b05d37413cfd2ba2a80b3a /public/index.xml | |
| parent | 22f5ac8fcec4dbfcc1f5033f18bc4eeca52a747d (diff) | |
| download | mitjafelicijan.com-f59672679db271f6b24a41e215401ab5001ecd96.tar.gz | |
Theme updates
Diffstat (limited to 'public/index.xml')
| -rwxr-xr-x | public/index.xml | 150 |
1 files changed, 71 insertions, 79 deletions
diff --git a/public/index.xml b/public/index.xml index 6acb85b..93fd748 100755 --- a/public/index.xml +++ b/public/index.xml | |||
| @@ -1449,32 +1449,31 @@ however.</p> | |||
| 1449 | </span></span><span style="display:flex;"><span>gnuplot audio.gpi | 1449 | </span></span><span style="display:flex;"><span>gnuplot audio.gpi |
| 1450 | </span></span></code></pre><p>And input file <code>audio.gpi</code> that would be passed to gnuplot looks something like | 1450 | </span></span></code></pre><p>And input file <code>audio.gpi</code> that would be passed to gnuplot looks something like |
| 1451 | this.</p> | 1451 | this.</p> |
| 1452 | <pre><code># set output format and size | 1452 | <pre tabindex="0" style="background-color:#fff;"><code><span style="display:flex;"><span># set output format and size |
| 1453 | set term png size 1000,280 | 1453 | </span></span><span style="display:flex;"><span>set term png size 1000,280 |
| 1454 | 1454 | </span></span><span style="display:flex;"><span> | |
| 1455 | # set output file | 1455 | </span></span><span style="display:flex;"><span># set output file |
| 1456 | set output &quot;audio.png&quot; | 1456 | </span></span><span style="display:flex;"><span>set output &#34;audio.png&#34; |
| 1457 | 1457 | </span></span><span style="display:flex;"><span> | |
| 1458 | # set y range | 1458 | </span></span><span style="display:flex;"><span># set y range |
| 1459 | set yr [-1:1] | 1459 | </span></span><span style="display:flex;"><span>set yr [-1:1] |
| 1460 | 1460 | </span></span><span style="display:flex;"><span> | |
| 1461 | # we want just the data | 1461 | </span></span><span style="display:flex;"><span># we want just the data |
| 1462 | unset key | 1462 | </span></span><span style="display:flex;"><span>unset key |
| 1463 | unset tics | 1463 | </span></span><span style="display:flex;"><span>unset tics |
| 1464 | unset border | 1464 | </span></span><span style="display:flex;"><span>unset border |
| 1465 | set lmargin 0 | 1465 | </span></span><span style="display:flex;"><span>set lmargin 0 |
| 1466 | set rmargin 0 | 1466 | </span></span><span style="display:flex;"><span>set rmargin 0 |
| 1467 | set tmargin 0 | 1467 | </span></span><span style="display:flex;"><span>set tmargin 0 |
| 1468 | set bmargin 0 | 1468 | </span></span><span style="display:flex;"><span>set bmargin 0 |
| 1469 | 1469 | </span></span><span style="display:flex;"><span> | |
| 1470 | # draw rectangle to change background color | 1470 | </span></span><span style="display:flex;"><span># draw rectangle to change background color |
| 1471 | set obj 1 rectangle behind from screen 0,0 to screen 1,1 | 1471 | </span></span><span style="display:flex;"><span>set obj 1 rectangle behind from screen 0,0 to screen 1,1 |
| 1472 | set obj 1 fillstyle solid 1.0 fillcolor rgbcolor &quot;#ffffff&quot; | 1472 | </span></span><span style="display:flex;"><span>set obj 1 fillstyle solid 1.0 fillcolor rgbcolor &#34;#ffffff&#34; |
| 1473 | 1473 | </span></span><span style="display:flex;"><span> | |
| 1474 | # draw data with foreground color | 1474 | </span></span><span style="display:flex;"><span># draw data with foreground color |
| 1475 | plot &quot;audio_only.dat&quot; with lines lt rgb 'red' | 1475 | </span></span><span style="display:flex;"><span>plot &#34;audio_only.dat&#34; with lines lt rgb &#39;red&#39; |
| 1476 | </code></pre> | 1476 | </span></span></code></pre><h2 id="pre-generated-sequences">Pre-generated sequences</h2> |
| 1477 | <h2 id="pre-generated-sequences">Pre-generated sequences</h2> | ||
| 1478 | <p>What I did was take interesting parts from an animal's genome and feed it to a | 1477 | <p>What I did was take interesting parts from an animal's genome and feed it to a |
| 1479 | tone generator script. This then generated a WAV file and I converted those to | 1478 | tone generator script. This then generated a WAV file and I converted those to |
| 1480 | MP3, so they can be played in a browser. The last step was creating a | 1479 | MP3, so they can be played in a browser. The last step was creating a |
| @@ -1926,13 +1925,12 @@ Lets create a folder <code>bin/</code> in the root of our project wi | |||
| 1926 | <p>At this point we can copy <code>bzImage</code> to <code>bin/</code> folder with | 1925 | <p>At this point we can copy <code>bzImage</code> to <code>bin/</code> folder with |
| 1927 | <code>cp linux-5.15.7/arch/x86_64/boot/bzImage bin/bzImage</code>.</p> | 1926 | <code>cp linux-5.15.7/arch/x86_64/boot/bzImage bin/bzImage</code>.</p> |
| 1928 | <p>The folder structure of this experiment should look like this.</p> | 1927 | <p>The folder structure of this experiment should look like this.</p> |
| 1929 | <pre><code>pid1/ | 1928 | <pre tabindex="0" style="background-color:#fff;"><code><span style="display:flex;"><span>pid1/ |
| 1930 | bin/ | 1929 | </span></span><span style="display:flex;"><span> bin/ |
| 1931 | bzImage | 1930 | </span></span><span style="display:flex;"><span> bzImage |
| 1932 | linux-5.15.7/ | 1931 | </span></span><span style="display:flex;"><span> linux-5.15.7/ |
| 1933 | linux-5.15.7.tar.xz | 1932 | </span></span><span style="display:flex;"><span> linux-5.15.7.tar.xz |
| 1934 | </code></pre> | 1933 | </span></span></code></pre><h2 id="preparing-pid-1-application-in-golang">Preparing PID 1 application in Golang</h2> |
| 1935 | <h2 id="preparing-pid-1-application-in-golang">Preparing PID 1 application in Golang</h2> | ||
| 1936 | <p>This step is relatively easy. The only thing we must have in mind that we will | 1934 | <p>This step is relatively easy. The only thing we must have in mind that we will |
| 1937 | need to compile the binary as a static one.</p> | 1935 | need to compile the binary as a static one.</p> |
| 1938 | <p>Let's create <code>init.go</code> file in the root of the project.</p> | 1936 | <p>Let's create <code>init.go</code> file in the root of the project.</p> |
| @@ -1968,15 +1966,14 @@ during the Linux startup process).</p> | |||
| 1968 | <pre tabindex="0" style="background-color:#fff;"><code><span style="display:flex;"><span>$ echo init | cpio -o --format=newc &gt; initramfs | 1966 | <pre tabindex="0" style="background-color:#fff;"><code><span style="display:flex;"><span>$ echo init | cpio -o --format=newc &gt; initramfs |
| 1969 | </span></span><span style="display:flex;"><span>$ mv initramfs bin/initramfs | 1967 | </span></span><span style="display:flex;"><span>$ mv initramfs bin/initramfs |
| 1970 | </span></span></code></pre><p>The projects at this stage should look like this.</p> | 1968 | </span></span></code></pre><p>The projects at this stage should look like this.</p> |
| 1971 | <pre><code>pid1/ | 1969 | <pre tabindex="0" style="background-color:#fff;"><code><span style="display:flex;"><span>pid1/ |
| 1972 | bin/ | 1970 | </span></span><span style="display:flex;"><span> bin/ |
| 1973 | bzImage | 1971 | </span></span><span style="display:flex;"><span> bzImage |
| 1974 | initramfs | 1972 | </span></span><span style="display:flex;"><span> initramfs |
| 1975 | linux-5.15.7/ | 1973 | </span></span><span style="display:flex;"><span> linux-5.15.7/ |
| 1976 | linux-5.15.7.tar.xz | 1974 | </span></span><span style="display:flex;"><span> linux-5.15.7.tar.xz |
| 1977 | init.go | 1975 | </span></span><span style="display:flex;"><span> init.go |
| 1978 | </code></pre> | 1976 | </span></span></code></pre><h2 id="running-all-of-it-with-qemu">Running all of it with QEMU</h2> |
| 1979 | <h2 id="running-all-of-it-with-qemu">Running all of it with QEMU</h2> | ||
| 1980 | <p><a href="https://www.qemu.org/">QEMU</a> is a free and open-source hypervisor. It emulates | 1977 | <p><a href="https://www.qemu.org/">QEMU</a> is a free and open-source hypervisor. It emulates |
| 1981 | the machine's processor through dynamic binary translation and provides a set | 1978 | the machine's processor through dynamic binary translation and provides a set |
| 1982 | of different hardware and device models for the machine, enabling it to run a | 1979 | of different hardware and device models for the machine, enabling it to run a |
| @@ -2876,9 +2873,8 @@ going on.</p> | |||
| 2876 | or Python's <code>.venv</code> and <code>.git</code> folders.</p> | 2873 | or Python's <code>.venv</code> and <code>.git</code> folders.</p> |
| 2877 | </blockquote> | 2874 | </blockquote> |
| 2878 | <p>You can use this script in a combination with <a href="https://en.wikipedia.org/wiki/Cron">Cron</a>.</p> | 2875 | <p>You can use this script in a combination with <a href="https://en.wikipedia.org/wiki/Cron">Cron</a>.</p> |
| 2879 | <pre><code>0 2 * * * sh ~/Vault/bin/vault-backup.sh | 2876 | <pre tabindex="0" style="background-color:#fff;"><code><span style="display:flex;"><span>0 2 * * * sh ~/Vault/bin/vault-backup.sh |
| 2880 | </code></pre> | 2877 | </span></span></code></pre><p>When you start syncing your local stuff with a remote server you can review your |
| 2881 | <p>When you start syncing your local stuff with a remote server you can review your | ||
| 2882 | items on DigitalOcean.</p> | 2878 | items on DigitalOcean.</p> |
| 2883 | <figure> | 2879 | <figure> |
| 2884 | <img src="/posts/dropbox-sync/dropbox-spaces.png" alt="Dropbox Spaces" /> | 2880 | <img src="/posts/dropbox-sync/dropbox-spaces.png" alt="Dropbox Spaces" /> |
| @@ -4272,9 +4268,7 @@ could encode also this data as long as you provide file pointer to the encoder.& | |||
| 4272 | <p>As already mentioned, the Basic Encoding is based on a simple mapping. Since DNA | 4268 | <p>As already mentioned, the Basic Encoding is based on a simple mapping. Since DNA |
| 4273 | is composed of 4 nucleotides (Adenine, Cytosine, Guanine, Thymine; usually | 4269 | is composed of 4 nucleotides (Adenine, Cytosine, Guanine, Thymine; usually |
| 4274 | referred using the first letter). Using this technique we can encode</p> | 4270 | referred using the first letter). Using this technique we can encode</p> |
| 4275 | <center> | 4271 | <p><svg xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" viewBox="0 -907.9672135000189 11313.37788460873 1185.0382429179317" style="width: 26.259ex; height: 2.721ex; vertical-align: -0.68ex; margin: 1px 0px;"><g stroke="black" fill="black" stroke-width="0" transform="matrix(1 0 0 -1 0 0)"><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-6C"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-6F" x="303" y="0"/><g transform="translate(793,0)"><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-67"/><use transform="scale(0.7071067811865476)" xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-32" x="681" y="-213"/></g><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-28" x="1732" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-34" x="2126" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-29" x="2631" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-3D" x="3302" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-6C" x="4363" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-6F" x="4666" y="0"/><g transform="translate(5156,0)"><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-67"/><use transform="scale(0.7071067811865476)" xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-32" x="681" y="-213"/></g><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-28" x="6095" y="0"/><g transform="translate(6489,0)"><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-32"/><use transform="scale(0.7071067811865476)" xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-32" x="714" y="583"/></g><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-29" x="7451" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-3D" x="8123" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-32" x="9184" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-62" x="9689" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-69" x="10123" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-74" x="10473" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-73" x="10839" y="0"/></g><defs id="MathJax_SVG_glyphs"><path id="MJSZ2-2211" stroke-width="10" d="M60 948Q63 950 665 950H1267L1325 815Q1384 677 1388 669H1348L1341 683Q1320 724 1285 761Q1235 809 1174 838T1033 881T882 898T699 902H574H543H251L259 891Q722 258 724 252Q725 250 724 246Q721 243 460 -56L196 -356Q196 -357 407 -357Q459 -357 548 -357T676 -358Q812 -358 896 -353T1063 -332T1204 -283T1307 -196Q1328 -170 1348 -124H1388Q1388 -125 1381 -145T1356 -210T1325 -294L1267 -449L666 -450Q64 -450 61 -448Q55 -446 55 -439Q55 -437 57 -433L590 177Q590 178 557 222T452 366T322 544L56 909L55 924Q55 945 60 948Z"/><path id="MJMATHI-69" stroke-width="10" d="M184 600Q184 624 203 642T247 661Q265 661 277 649T290 619Q290 596 270 577T226 557Q211 557 198 567T184 600ZM21 287Q21 295 30 318T54 369T98 420T158 442Q197 442 223 419T250 357Q250 340 236 301T196 196T154 83Q149 61 149 51Q149 26 166 26Q175 26 185 29T208 43T235 78T260 137Q263 149 265 151T282 153Q302 153 302 143Q302 135 293 112T268 61T223 11T161 -11Q129 -11 102 10T74 74Q74 91 79 106T122 220Q160 321 166 341T173 380Q173 404 156 404H154Q124 404 99 371T61 287Q60 286 59 284T58 281T56 279T53 278T49 278T41 278H27Q21 284 21 287Z"/><path id="MJMAIN-3D" stroke-width="10" d="M56 347Q56 360 70 367H707Q722 359 722 347Q722 336 708 328L390 327H72Q56 332 56 347ZM56 153Q56 168 72 173H708Q722 163 722 153Q722 140 707 133H70Q56 140 56 153Z"/><path id="MJMAIN-30" stroke-width="10" d="M96 585Q152 666 249 666Q297 666 345 640T423 548Q460 465 460 320Q460 165 417 83Q397 41 362 16T301 -15T250 -22Q224 -22 198 -16T137 16T82 83Q39 165 39 320Q39 494 96 585ZM321 597Q291 629 250 629Q208 629 178 597Q153 571 145 525T137 333Q137 175 145 125T181 46Q209 16 250 16Q290 16 318 46Q347 76 354 130T362 333Q362 478 354 524T321 597Z"/><path id="MJMATHI-6E" stroke-width="10" d="M21 287Q22 293 24 303T36 341T56 388T89 425T135 442Q171 442 195 424T225 390T231 369Q231 367 232 367L243 378Q304 442 382 442Q436 442 469 415T503 336T465 179T427 52Q427 26 444 26Q450 26 453 27Q482 32 505 65T540 145Q542 153 560 153Q580 153 580 145Q580 144 576 130Q568 101 554 73T508 17T439 -10Q392 -10 371 17T350 73Q350 92 386 193T423 345Q423 404 379 404H374Q288 404 229 303L222 291L189 157Q156 26 151 16Q138 -11 108 -11Q95 -11 87 -5T76 7T74 17Q74 30 112 180T152 343Q153 348 153 366Q153 405 129 405Q91 405 66 305Q60 285 60 284Q58 278 41 278H27Q21 284 21 287Z"/><path id="MJMAIN-28" stroke-width="10" d="M94 250Q94 319 104 381T127 488T164 576T202 643T244 695T277 729T302 750H315H319Q333 750 333 741Q333 738 316 720T275 667T226 581T184 443T167 250T184 58T225 -81T274 -167T316 -220T333 -241Q333 -250 318 -250H315H302L274 -226Q180 -141 137 -14T94 250Z"/><path id="MJMAIN-2B" stroke-width="10" d="M56 237T56 250T70 270H369V420L370 570Q380 583 389 583Q402 583 409 568V270H707Q722 262 722 250T707 230H409V-68Q401 -82 391 -82H389H387Q375 -82 369 -68V230H70Q56 237 56 250Z"/><path id="MJMAIN-31" stroke-width="10" d="M213 578L200 573Q186 568 160 563T102 556H83V602H102Q149 604 189 617T245 641T273 663Q275 666 285 666Q294 666 302 660V361L303 61Q310 54 315 52T339 48T401 46H427V0H416Q395 3 257 3Q121 3 100 0H88V46H114Q136 46 152 46T177 47T193 50T201 52T207 57T213 61V578Z"/><path id="MJMAIN-29" stroke-width="10" d="M60 749L64 750Q69 750 74 750H86L114 726Q208 641 251 514T294 250Q294 182 284 119T261 12T224 -76T186 -143T145 -194T113 -227T90 -246Q87 -249 86 -250H74Q66 -250 63 -250T58 -247T55 -238Q56 -237 66 -225Q221 -64 221 250T66 725Q56 737 55 738Q55 746 60 749Z"/><path id="MJMAIN-32" stroke-width="10" d="M109 429Q82 429 66 447T50 491Q50 562 103 614T235 666Q326 666 387 610T449 465Q449 422 429 383T381 315T301 241Q265 210 201 149L142 93L218 92Q375 92 385 97Q392 99 409 186V189H449V186Q448 183 436 95T421 3V0H50V19V31Q50 38 56 46T86 81Q115 113 136 137Q145 147 170 174T204 211T233 244T261 278T284 308T305 340T320 369T333 401T340 431T343 464Q343 527 309 573T212 619Q179 619 154 602T119 569T109 550Q109 549 114 549Q132 549 151 535T170 489Q170 464 154 447T109 429Z"/><path id="MJMATHI-6C" stroke-width="10" d="M117 59Q117 26 142 26Q179 26 205 131Q211 151 215 152Q217 153 225 153H229Q238 153 241 153T246 151T248 144Q247 138 245 128T234 90T214 43T183 6T137 -11Q101 -11 70 11T38 85Q38 97 39 102L104 360Q167 615 167 623Q167 626 166 628T162 632T157 634T149 635T141 636T132 637T122 637Q112 637 109 637T101 638T95 641T94 647Q94 649 96 661Q101 680 107 682T179 688Q194 689 213 690T243 693T254 694Q266 694 266 686Q266 675 193 386T118 83Q118 81 118 75T117 65V59Z"/><path id="MJMATHI-6F" stroke-width="10" d="M201 -11Q126 -11 80 38T34 156Q34 221 64 279T146 380Q222 441 301 441Q333 441 341 440Q354 437 367 433T402 417T438 387T464 338T476 268Q476 161 390 75T201 -11ZM121 120Q121 70 147 48T206 26Q250 26 289 58T351 142Q360 163 374 216T388 308Q388 352 370 375Q346 405 306 405Q243 405 195 347Q158 303 140 230T121 120Z"/><path id="MJMATHI-67" stroke-width="10" d="M311 43Q296 30 267 15T206 0Q143 0 105 45T66 160Q66 265 143 353T314 442Q361 442 401 394L404 398Q406 401 409 404T418 412T431 419T447 422Q461 422 470 413T480 394Q480 379 423 152T363 -80Q345 -134 286 -169T151 -205Q10 -205 10 -137Q10 -111 28 -91T74 -71Q89 -71 102 -80T116 -111Q116 -121 114 -130T107 -144T99 -154T92 -162L90 -164H91Q101 -167 151 -167Q189 -167 211 -155Q234 -144 254 -122T282 -75Q288 -56 298 -13Q311 35 311 43ZM384 328L380 339Q377 350 375 354T369 368T359 382T346 393T328 402T306 405Q262 405 221 352Q191 313 171 233T151 117Q151 38 213 38Q269 38 323 108L331 118L384 328Z"/><path id="MJMAIN-34" stroke-width="10" d="M462 0Q444 3 333 3Q217 3 199 0H190V46H221Q241 46 248 46T265 48T279 53T286 61Q287 63 287 115V165H28V211L179 442Q332 674 334 675Q336 677 355 677H373L379 671V211H471V165H379V114Q379 73 379 66T385 54Q393 47 442 46H471V0H462ZM293 211V545L74 212L183 211H293Z"/><path id="MJMATHI-62" stroke-width="10" d="M73 647Q73 657 77 670T89 683Q90 683 161 688T234 694Q246 694 246 685T212 542Q204 508 195 472T180 418L176 399Q176 396 182 402Q231 442 283 442Q345 442 383 396T422 280Q422 169 343 79T173 -11Q123 -11 82 27T40 150V159Q40 180 48 217T97 414Q147 611 147 623T109 637Q104 637 101 637H96Q86 637 83 637T76 640T73 647ZM336 325V331Q336 405 275 405Q258 405 240 397T207 376T181 352T163 330L157 322L136 236Q114 150 114 114Q114 66 138 42Q154 26 178 26Q211 26 245 58Q270 81 285 114T318 219Q336 291 336 325Z"/><path id="MJMATHI-74" stroke-width="10" d="M26 385Q19 392 19 395Q19 399 22 411T27 425Q29 430 36 430T87 431H140L159 511Q162 522 166 540T173 566T179 586T187 603T197 615T211 624T229 626Q247 625 254 615T261 596Q261 589 252 549T232 470L222 433Q222 431 272 431H323Q330 424 330 420Q330 398 317 385H210L174 240Q135 80 135 68Q135 26 162 26Q197 26 230 60T283 144Q285 150 288 151T303 153H307Q322 153 322 145Q322 142 319 133Q314 117 301 95T267 48T216 6T155 -11Q125 -11 98 4T59 56Q57 64 57 83V101L92 241Q127 382 128 383Q128 385 77 385H26Z"/><path id="MJMATHI-73" stroke-width="10" d="M131 289Q131 321 147 354T203 415T300 442Q362 442 390 415T419 355Q419 323 402 308T364 292Q351 292 340 300T328 326Q328 342 337 354T354 372T367 378Q368 378 368 379Q368 382 361 388T336 399T297 405Q249 405 227 379T204 326Q204 301 223 291T278 274T330 259Q396 230 396 163Q396 135 385 107T352 51T289 7T195 -10Q118 -10 86 19T53 87Q53 126 74 143T118 160Q133 160 146 151T160 120Q160 94 142 76T111 58Q109 57 108 57T107 55Q108 52 115 47T146 34T201 27Q237 27 263 38T301 66T318 97T323 122Q323 150 302 164T254 181T195 196T148 231Q131 256 131 289Z"/></defs></svg></p> |
| 4276 | <svg xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" viewBox="0 -907.9672135000189 11313.37788460873 1185.0382429179317" style="width: 26.259ex; height: 2.721ex; vertical-align: -0.68ex; margin: 1px 0px;"><g stroke="black" fill="black" stroke-width="0" transform="matrix(1 0 0 -1 0 0)"><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-6C"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-6F" x="303" y="0"/><g transform="translate(793,0)"><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-67"/><use transform="scale(0.7071067811865476)" xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-32" x="681" y="-213"/></g><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-28" x="1732" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-34" x="2126" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-29" x="2631" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-3D" x="3302" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-6C" x="4363" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-6F" x="4666" y="0"/><g transform="translate(5156,0)"><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-67"/><use transform="scale(0.7071067811865476)" xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-32" x="681" y="-213"/></g><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-28" x="6095" y="0"/><g transform="translate(6489,0)"><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-32"/><use transform="scale(0.7071067811865476)" xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-32" x="714" y="583"/></g><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-29" x="7451" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-3D" x="8123" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMAIN-32" x="9184" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-62" x="9689" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-69" x="10123" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-74" x="10473" y="0"/><use xmlns:xlink="http://www.w3.org/1999/xlink" xlink:href="#MJMATHI-73" x="10839" y="0"/></g><defs id="MathJax_SVG_glyphs"><path id="MJSZ2-2211" stroke-width="10" d="M60 948Q63 950 665 950H1267L1325 815Q1384 677 1388 669H1348L1341 683Q1320 724 1285 761Q1235 809 1174 838T1033 881T882 898T699 902H574H543H251L259 891Q722 258 724 252Q725 250 724 246Q721 243 460 -56L196 -356Q196 -357 407 -357Q459 -357 548 -357T676 -358Q812 -358 896 -353T1063 -332T1204 -283T1307 -196Q1328 -170 1348 -124H1388Q1388 -125 1381 -145T1356 -210T1325 -294L1267 -449L666 -450Q64 -450 61 -448Q55 -446 55 -439Q55 -437 57 -433L590 177Q590 178 557 222T452 366T322 544L56 909L55 924Q55 945 60 948Z"/><path id="MJMATHI-69" stroke-width="10" d="M184 600Q184 624 203 642T247 661Q265 661 277 649T290 619Q290 596 270 577T226 557Q211 557 198 567T184 600ZM21 287Q21 295 30 318T54 369T98 420T158 442Q197 442 223 419T250 357Q250 340 236 301T196 196T154 83Q149 61 149 51Q149 26 166 26Q175 26 185 29T208 43T235 78T260 137Q263 149 265 151T282 153Q302 153 302 143Q302 135 293 112T268 61T223 11T161 -11Q129 -11 102 10T74 74Q74 91 79 106T122 220Q160 321 166 341T173 380Q173 404 156 404H154Q124 404 99 371T61 287Q60 286 59 284T58 281T56 279T53 278T49 278T41 278H27Q21 284 21 287Z"/><path id="MJMAIN-3D" stroke-width="10" d="M56 347Q56 360 70 367H707Q722 359 722 347Q722 336 708 328L390 327H72Q56 332 56 347ZM56 153Q56 168 72 173H708Q722 163 722 153Q722 140 707 133H70Q56 140 56 153Z"/><path id="MJMAIN-30" stroke-width="10" d="M96 585Q152 666 249 666Q297 666 345 640T423 548Q460 465 460 320Q460 165 417 83Q397 41 362 16T301 -15T250 -22Q224 -22 198 -16T137 16T82 83Q39 165 39 320Q39 494 96 585ZM321 597Q291 629 250 629Q208 629 178 597Q153 571 145 525T137 333Q137 175 145 125T181 46Q209 16 250 16Q290 16 318 46Q347 76 354 130T362 333Q362 478 354 524T321 597Z"/><path id="MJMATHI-6E" stroke-width="10" d="M21 287Q22 293 24 303T36 341T56 388T89 425T135 442Q171 442 195 424T225 390T231 369Q231 367 232 367L243 378Q304 442 382 442Q436 442 469 415T503 336T465 179T427 52Q427 26 444 26Q450 26 453 27Q482 32 505 65T540 145Q542 153 560 153Q580 153 580 145Q580 144 576 130Q568 101 554 73T508 17T439 -10Q392 -10 371 17T350 73Q350 92 386 193T423 345Q423 404 379 404H374Q288 404 229 303L222 291L189 157Q156 26 151 16Q138 -11 108 -11Q95 -11 87 -5T76 7T74 17Q74 30 112 180T152 343Q153 348 153 366Q153 405 129 405Q91 405 66 305Q60 285 60 284Q58 278 41 278H27Q21 284 21 287Z"/><path id="MJMAIN-28" stroke-width="10" d="M94 250Q94 319 104 381T127 488T164 576T202 643T244 695T277 729T302 750H315H319Q333 750 333 741Q333 738 316 720T275 667T226 581T184 443T167 250T184 58T225 -81T274 -167T316 -220T333 -241Q333 -250 318 -250H315H302L274 -226Q180 -141 137 -14T94 250Z"/><path id="MJMAIN-2B" stroke-width="10" d="M56 237T56 250T70 270H369V420L370 570Q380 583 389 583Q402 583 409 568V270H707Q722 262 722 250T707 230H409V-68Q401 -82 391 -82H389H387Q375 -82 369 -68V230H70Q56 237 56 250Z"/><path id="MJMAIN-31" stroke-width="10" d="M213 578L200 573Q186 568 160 563T102 556H83V602H102Q149 604 189 617T245 641T273 663Q275 666 285 666Q294 666 302 660V361L303 61Q310 54 315 52T339 48T401 46H427V0H416Q395 3 257 3Q121 3 100 0H88V46H114Q136 46 152 46T177 47T193 50T201 52T207 57T213 61V578Z"/><path id="MJMAIN-29" stroke-width="10" d="M60 749L64 750Q69 750 74 750H86L114 726Q208 641 251 514T294 250Q294 182 284 119T261 12T224 -76T186 -143T145 -194T113 -227T90 -246Q87 -249 86 -250H74Q66 -250 63 -250T58 -247T55 -238Q56 -237 66 -225Q221 -64 221 250T66 725Q56 737 55 738Q55 746 60 749Z"/><path id="MJMAIN-32" stroke-width="10" d="M109 429Q82 429 66 447T50 491Q50 562 103 614T235 666Q326 666 387 610T449 465Q449 422 429 383T381 315T301 241Q265 210 201 149L142 93L218 92Q375 92 385 97Q392 99 409 186V189H449V186Q448 183 436 95T421 3V0H50V19V31Q50 38 56 46T86 81Q115 113 136 137Q145 147 170 174T204 211T233 244T261 278T284 308T305 340T320 369T333 401T340 431T343 464Q343 527 309 573T212 619Q179 619 154 602T119 569T109 550Q109 549 114 549Q132 549 151 535T170 489Q170 464 154 447T109 429Z"/><path id="MJMATHI-6C" stroke-width="10" d="M117 59Q117 26 142 26Q179 26 205 131Q211 151 215 152Q217 153 225 153H229Q238 153 241 153T246 151T248 144Q247 138 245 128T234 90T214 43T183 6T137 -11Q101 -11 70 11T38 85Q38 97 39 102L104 360Q167 615 167 623Q167 626 166 628T162 632T157 634T149 635T141 636T132 637T122 637Q112 637 109 637T101 638T95 641T94 647Q94 649 96 661Q101 680 107 682T179 688Q194 689 213 690T243 693T254 694Q266 694 266 686Q266 675 193 386T118 83Q118 81 118 75T117 65V59Z"/><path id="MJMATHI-6F" stroke-width="10" d="M201 -11Q126 -11 80 38T34 156Q34 221 64 279T146 380Q222 441 301 441Q333 441 341 440Q354 437 367 433T402 417T438 387T464 338T476 268Q476 161 390 75T201 -11ZM121 120Q121 70 147 48T206 26Q250 26 289 58T351 142Q360 163 374 216T388 308Q388 352 370 375Q346 405 306 405Q243 405 195 347Q158 303 140 230T121 120Z"/><path id="MJMATHI-67" stroke-width="10" d="M311 43Q296 30 267 15T206 0Q143 0 105 45T66 160Q66 265 143 353T314 442Q361 442 401 394L404 398Q406 401 409 404T418 412T431 419T447 422Q461 422 470 413T480 394Q480 379 423 152T363 -80Q345 -134 286 -169T151 -205Q10 -205 10 -137Q10 -111 28 -91T74 -71Q89 -71 102 -80T116 -111Q116 -121 114 -130T107 -144T99 -154T92 -162L90 -164H91Q101 -167 151 -167Q189 -167 211 -155Q234 -144 254 -122T282 -75Q288 -56 298 -13Q311 35 311 43ZM384 328L380 339Q377 350 375 354T369 368T359 382T346 393T328 402T306 405Q262 405 221 352Q191 313 171 233T151 117Q151 38 213 38Q269 38 323 108L331 118L384 328Z"/><path id="MJMAIN-34" stroke-width="10" d="M462 0Q444 3 333 3Q217 3 199 0H190V46H221Q241 46 248 46T265 48T279 53T286 61Q287 63 287 115V165H28V211L179 442Q332 674 334 675Q336 677 355 677H373L379 671V211H471V165H379V114Q379 73 379 66T385 54Q393 47 442 46H471V0H462ZM293 211V545L74 212L183 211H293Z"/><path id="MJMATHI-62" stroke-width="10" d="M73 647Q73 657 77 670T89 683Q90 683 161 688T234 694Q246 694 246 685T212 542Q204 508 195 472T180 418L176 399Q176 396 182 402Q231 442 283 442Q345 442 383 396T422 280Q422 169 343 79T173 -11Q123 -11 82 27T40 150V159Q40 180 48 217T97 414Q147 611 147 623T109 637Q104 637 101 637H96Q86 637 83 637T76 640T73 647ZM336 325V331Q336 405 275 405Q258 405 240 397T207 376T181 352T163 330L157 322L136 236Q114 150 114 114Q114 66 138 42Q154 26 178 26Q211 26 245 58Q270 81 285 114T318 219Q336 291 336 325Z"/><path id="MJMATHI-74" stroke-width="10" d="M26 385Q19 392 19 395Q19 399 22 411T27 425Q29 430 36 430T87 431H140L159 511Q162 522 166 540T173 566T179 586T187 603T197 615T211 624T229 626Q247 625 254 615T261 596Q261 589 252 549T232 470L222 433Q222 431 272 431H323Q330 424 330 420Q330 398 317 385H210L174 240Q135 80 135 68Q135 26 162 26Q197 26 230 60T283 144Q285 150 288 151T303 153H307Q322 153 322 145Q322 142 319 133Q314 117 301 95T267 48T216 6T155 -11Q125 -11 98 4T59 56Q57 64 57 83V101L92 241Q127 382 128 383Q128 385 77 385H26Z"/><path id="MJMATHI-73" stroke-width="10" d="M131 289Q131 321 147 354T203 415T300 442Q362 442 390 415T419 355Q419 323 402 308T364 292Q351 292 340 300T328 326Q328 342 337 354T354 372T367 378Q368 378 368 379Q368 382 361 388T336 399T297 405Q249 405 227 379T204 326Q204 301 223 291T278 274T330 259Q396 230 396 163Q396 135 385 107T352 51T289 7T195 -10Q118 -10 86 19T53 87Q53 126 74 143T118 160Q133 160 146 151T160 120Q160 94 142 76T111 58Q109 57 108 57T107 55Q108 52 115 47T146 34T201 27Q237 27 263 38T301 66T318 97T323 122Q323 150 302 164T254 181T195 196T148 231Q131 256 131 289Z"/></defs></svg> | ||
| 4277 | </center> | ||
| 4278 | <p>using a single nucleotide. In this way, we are able to use the 4 bases that | 4272 | <p>using a single nucleotide. In this way, we are able to use the 4 bases that |
| 4279 | compose the DNA strand to encode each byte of data.</p> | 4273 | compose the DNA strand to encode each byte of data.</p> |
| 4280 | <table> | 4274 | <table> |
| @@ -4342,26 +4336,25 @@ used was the first, it quickly became used to hold a summary description of the | |||
| 4342 | sequence, often starting with a unique library accession number, and with time | 4336 | sequence, often starting with a unique library accession number, and with time |
| 4343 | it has become commonplace to always use &quot;&gt;&quot; for the first line and to not use | 4337 | it has become commonplace to always use &quot;&gt;&quot; for the first line and to not use |
| 4344 | &quot;;&quot; comments (which would otherwise be ignored).</p> | 4338 | &quot;;&quot; comments (which would otherwise be ignored).</p> |
| 4345 | <pre><code>;LCBO - Prolactin precursor - Bovine | 4339 | <pre tabindex="0" style="background-color:#fff;"><code><span style="display:flex;"><span>;LCBO - Prolactin precursor - Bovine |
| 4346 | ; a sample sequence in FASTA format | 4340 | </span></span><span style="display:flex;"><span>; a sample sequence in FASTA format |
| 4347 | MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSS | 4341 | </span></span><span style="display:flex;"><span>MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSS |
| 4348 | EMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHL | 4342 | </span></span><span style="display:flex;"><span>EMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHL |
| 4349 | VTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDED | 4343 | </span></span><span style="display:flex;"><span>VTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDED |
| 4350 | ARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC* | 4344 | </span></span><span style="display:flex;"><span>ARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC* |
| 4351 | 4345 | </span></span><span style="display:flex;"><span> | |
| 4352 | &gt;MCHU - Calmodulin - Human, rabbit, bovine, rat, and chicken | 4346 | </span></span><span style="display:flex;"><span>&gt;MCHU - Calmodulin - Human, rabbit, bovine, rat, and chicken |
| 4353 | ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID | 4347 | </span></span><span style="display:flex;"><span>ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID |
| 4354 | FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREA | 4348 | </span></span><span style="display:flex;"><span>FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREA |
| 4355 | DIDGDGQVNYEEFVQMMTAK* | 4349 | </span></span><span style="display:flex;"><span>DIDGDGQVNYEEFVQMMTAK* |
| 4356 | 4350 | </span></span><span style="display:flex;"><span> | |
| 4357 | &gt;gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus] | 4351 | </span></span><span style="display:flex;"><span>&gt;gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus] |
| 4358 | LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV | 4352 | </span></span><span style="display:flex;"><span>LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV |
| 4359 | EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG | 4353 | </span></span><span style="display:flex;"><span>EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG |
| 4360 | LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL | 4354 | </span></span><span style="display:flex;"><span>LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL |
| 4361 | GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX | 4355 | </span></span><span style="display:flex;"><span>GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX |
| 4362 | IENY | 4356 | </span></span><span style="display:flex;"><span>IENY |
| 4363 | </code></pre> | 4357 | </span></span></code></pre><p>FASTA format was extended by <a href="https://en.wikipedia.org/wiki/FASTQ_format">FASTQ</a> |
| 4364 | <p>FASTA format was extended by <a href="https://en.wikipedia.org/wiki/FASTQ_format">FASTQ</a> | ||
| 4365 | format from the <a href="https://www.sanger.ac.uk/">Sanger Centre</a> in Cambridge.</p> | 4358 | format from the <a href="https://www.sanger.ac.uk/">Sanger Centre</a> in Cambridge.</p> |
| 4366 | <h3 id="png-encoded-dna-sequence">PNG encoded DNA sequence</h3> | 4359 | <h3 id="png-encoded-dna-sequence">PNG encoded DNA sequence</h3> |
| 4367 | <table> | 4360 | <table> |
| @@ -4429,17 +4422,16 @@ making progress. | |||
| 4429 | </span></span><span style="display:flex;"><span>2019/01/10 00:38:29 Process took 987.263µs | 4422 | </span></span><span style="display:flex;"><span>2019/01/10 00:38:29 Process took 987.263µs |
| 4430 | </span></span><span style="display:flex;"><span>2019/01/10 00:38:29 Done ... | 4423 | </span></span><span style="display:flex;"><span>2019/01/10 00:38:29 Done ... |
| 4431 | </span></span></code></pre><p>Output of <code>quote.fa</code> file contains the encoded DNA sequence in ASCII format.</p> | 4424 | </span></span></code></pre><p>Output of <code>quote.fa</code> file contains the encoded DNA sequence in ASCII format.</p> |
| 4432 | <pre><code>&gt;SEQ1 | 4425 | <pre tabindex="0" style="background-color:#fff;"><code><span style="display:flex;"><span>&gt;SEQ1 |
| 4433 | GACAGCTTGTGTACAAGTGTGCTTGCTCGCGAGCGGGTACGCGCGTGGGCTAACAAGTGA | 4426 | </span></span><span style="display:flex;"><span>GACAGCTTGTGTACAAGTGTGCTTGCTCGCGAGCGGGTACGCGCGTGGGCTAACAAGTGA |
| 4434 | GCCAGCAGGTGAACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGCTGGCGGGTGA | 4427 | </span></span><span style="display:flex;"><span>GCCAGCAGGTGAACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGCTGGCGGGTGA |
| 4435 | ACAAGTGTGCCGGTGAGCCAACAAGCAGACAAGTAAGCAGGTACGCAGGCGAGCTTGTCA | 4428 | </span></span><span style="display:flex;"><span>ACAAGTGTGCCGGTGAGCCAACAAGCAGACAAGTAAGCAGGTACGCAGGCGAGCTTGTCA |
| 4436 | ACTCACAAGATCGCTTGTGTACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGTAT | 4429 | </span></span><span style="display:flex;"><span>ACTCACAAGATCGCTTGTGTACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGTAT |
| 4437 | GCTTGCTGGCGGACAAGCCAGCTTGTAAGCGGACAAGCTTGCGCACAAGCTGGCAGGCCT | 4430 | </span></span><span style="display:flex;"><span>GCTTGCTGGCGGACAAGCCAGCTTGTAAGCGGACAAGCTTGCGCACAAGCTGGCAGGCCT |
| 4438 | GCCGGCTCGCGTACAAATTCACAAGTAAGTACGCTTGCGTGTACGCGGGTATGTATACTC | 4431 | </span></span><span style="display:flex;"><span>GCCGGCTCGCGTACAAATTCACAAGTAAGTACGCTTGCGTGTACGCGGGTATGTATACTC |
| 4439 | AACCTCACCAAACGGGACAAGATCGCCGGCGGGCTAGTATACAAGAACGCTTGCCAGTAC | 4432 | </span></span><span style="display:flex;"><span>AACCTCACCAAACGGGACAAGATCGCCGGCGGGCTAGTATACAAGAACGCTTGCCAGTAC |
| 4440 | AACC | 4433 | </span></span><span style="display:flex;"><span>AACC |
| 4441 | </code></pre> | 4434 | </span></span></code></pre><p>Then we encode FASTA file from previous operation to encode this data into PNG.</p> |
| 4442 | <p>Then we encode FASTA file from previous operation to encode this data into PNG.</p> | ||
| 4443 | <pre tabindex="0" style="background-color:#fff;"><code><span style="display:flex;"><span>./dnae-png -i quote.fa -o quote.png | 4435 | <pre tabindex="0" style="background-color:#fff;"><code><span style="display:flex;"><span>./dnae-png -i quote.fa -o quote.png |
| 4444 | </span></span><span style="display:flex;"><span>2019/01/10 00:40:09 Gathering input file stats ... | 4436 | </span></span><span style="display:flex;"><span>2019/01/10 00:40:09 Gathering input file stats ... |
| 4445 | </span></span><span style="display:flex;"><span>2019/01/10 00:40:09 Deconstructing FASTA file ... | 4437 | </span></span><span style="display:flex;"><span>2019/01/10 00:40:09 Deconstructing FASTA file ... |
