aboutsummaryrefslogtreecommitdiff
diff options
context:
space:
mode:
authorMitja Felicijan <mitja.felicijan@gmail.com>2022-06-28 19:02:56 +0200
committerMitja Felicijan <mitja.felicijan@gmail.com>2022-06-28 19:02:56 +0200
commit991d657e4c980e6d1114e4adb27f20332e1f7d6b (patch)
treed31f1d1de59e44a903883151807d9ae2efb23764
parent5d9882a2d613be98eb3fe0344a051ef6e7c4539f (diff)
downloadmitjafelicijan.com-991d657e4c980e6d1114e4adb27f20332e1f7d6b.tar.gz
Added new styles
-rw-r--r--Makefile17
-rw-r--r--assets/general/favicon.icobin0 -> 15406 bytes
-rw-r--r--posts/2019-01-03-encoding-binary-data-into-dna-sequence.md4
-rwxr-xr-xtemplate/_meta.html5
-rwxr-xr-xtemplate/post.html9
-rwxr-xr-xtemplate/style.css22
6 files changed, 33 insertions, 24 deletions
diff --git a/Makefile b/Makefile
index 6e9acf0..d6b6c09 100644
--- a/Makefile
+++ b/Makefile
@@ -11,29 +11,24 @@ dither:
11 bash tools/dither-images.sh 11 bash tools/dither-images.sh
12 12
13openring: 13openring:
14 openring -l 165 -n 4 -p 1 \ 14 mkdir -p public
15 -s https://cronokirby.com/posts/index.xml \ 15 openring -l 165 -n 5 -p 1 \
16 -s https://drewdevault.com/feed.xml \ 16 -s https://drewdevault.com/feed.xml \
17 -s https://danluu.com/atom.xml \ 17 -s https://danluu.com/atom.xml \
18 -s https://serokell.io/blog.rss.xml \ 18 -s https://serokell.io/blog.rss.xml \
19 -s https://cronokirby.com/posts/index.xml \
20 -s https://www.jeffgeerling.com/blog.xml \
19 < template/openring.tmpl \ 21 < template/openring.tmpl \
20 > template/openring-build.html 22 > template/openring-build.html
21 23
22dev: alternator server 24dev: alternator server
23 25
24alternator: openring 26alternator: openring
27 mkdir -p public
25 alternator --watch 28 alternator --watch
26 29
27build: 30build: openring
28 mkdir -p public 31 mkdir -p public
29 openring -l 165 -n 4 -p 1 \
30 -s https://cronokirby.com/posts/index.xml \
31 -s https://drewdevault.com/feed.xml \
32 -s https://danluu.com/atom.xml \
33 -s https://serokell.io/blog.rss.xml \
34 < template/openring.tmpl \
35 > template/openring-build.html
36
37 alternator --build 32 alternator --build
38 rm template/openring-build.html 33 rm template/openring-build.html
39 34
diff --git a/assets/general/favicon.ico b/assets/general/favicon.ico
new file mode 100644
index 0000000..c6b2ff4
--- /dev/null
+++ b/assets/general/favicon.ico
Binary files differ
diff --git a/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md b/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md
index fdbdf5b..4910bb3 100644
--- a/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md
+++ b/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md
@@ -147,7 +147,7 @@ In bioinformatics, FASTA format is a text-based format for representing either n
147 147
148The first line in a FASTA file started either with a ">" (greater-than) symbol or, less frequently, a ";" (semicolon) was taken as a comment. Subsequent lines starting with a semicolon would be ignored by software. Since the only comment used was the first, it quickly became used to hold a summary description of the sequence, often starting with a unique library accession number, and with time it has become commonplace to always use ">" for the first line and to not use ";" comments (which would otherwise be ignored). 148The first line in a FASTA file started either with a ">" (greater-than) symbol or, less frequently, a ";" (semicolon) was taken as a comment. Subsequent lines starting with a semicolon would be ignored by software. Since the only comment used was the first, it quickly became used to hold a summary description of the sequence, often starting with a unique library accession number, and with time it has become commonplace to always use ">" for the first line and to not use ";" comments (which would otherwise be ignored).
149 149
150```text 150```
151;LCBO - Prolactin precursor - Bovine 151;LCBO - Prolactin precursor - Bovine
152; a sample sequence in FASTA format 152; a sample sequence in FASTA format
153MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSS 153MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSS
@@ -220,7 +220,7 @@ First we encode text file into FASTA file.
220 220
221Output of `quote.fa` file contains the encoded DNA sequence in ASCII format. 221Output of `quote.fa` file contains the encoded DNA sequence in ASCII format.
222 222
223```text 223```
224>SEQ1 224>SEQ1
225GACAGCTTGTGTACAAGTGTGCTTGCTCGCGAGCGGGTACGCGCGTGGGCTAACAAGTGA 225GACAGCTTGTGTACAAGTGTGCTTGCTCGCGAGCGGGTACGCGCGTGGGCTAACAAGTGA
226GCCAGCAGGTGAACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGCTGGCGGGTGA 226GCCAGCAGGTGAACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGCTGGCGGGTGA
diff --git a/template/_meta.html b/template/_meta.html
index 23275a0..73a33d0 100755
--- a/template/_meta.html
+++ b/template/_meta.html
@@ -5,10 +5,11 @@
5 5
6<meta name="theme-color" content="#ffffff"> 6<meta name="theme-color" content="#ffffff">
7 7
8<link rel="stylesheet" href="/style.css?v=2022-06-11-00"> 8<link rel="stylesheet" href="/style.css?v=2022-06-28-4">
9 9
10<link rel="alternate" type="application/rss+xml" href="/feed.rss"> 10<link rel="alternate" type="application/rss+xml" href="/feed.rss">
11<link rel="alternate" type="application/feed+json" href="/feed.json"> 11<link rel="alternate" type="application/feed+json" href="/feed.json">
12<link rel="alternate" type="application/rss+xml" href="/yapyap.xml" title="YapYap"> 12<link rel="alternate" type="application/rss+xml" href="/yapyap.xml" title="YapYap">
13 13
14<link rel="icon" href="/assets/general/favicon.png?v=2021-12-07-1" type="image/png"> 14<!--<link rel="icon" href="/assets/general/favicon.png?v=2021-12-07-1" type="image/png">-->
15<link href="data:image/x-icon;base64,AAABAAEAEBAAAAEAIABoBAAAFgAAACgAAAAQAAAAIAAAAAEAIAAAAAAAAAQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAL69vf8AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAv76+/8LBwQkAAAAAAAAAAAAAAAC+vb3/AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAL+9vf/Bv78JAAAAAAAAAAAAAAAAu7q6/wAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAC7ubr/vr29CAAAAAAAAAAAy8nJAZ6foP8AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAnqGj/6GipAoAAAAAHLjU/xcXHf/BwsL/I8XY/yPK3v8XGiD/IbjL/yPF2f8XGiD/Fxkf/yLF2f8gnK3/Fxog/62ztv8fwNf/FRcd/x271v8mz93/GRsi/xkXHf8p097/GiIp/xobIv8p0t3/KdPe/xocIv8fYmr/KNPe/xoZH/8aHCL/J87c/xy81/8VFxz/IsPZ/8zS0/8XGiD/Ir/R/yPH2/8XGiD/Fxkf/yPH2/8dd4T/GBog/yPJ3f8jyNr/uru9/xcUGv8cudb/EhITDKi5vRKlvMP/RUpOERwcHRAdOj4QHTk8EBwdHRAdNTgQHTo/EBwcHRAcHB0QSGduEKW4vf+koqQfHzg+EBqz0ewSFRv7EyMr/xq51vsTERb7ExUb+xq41fsau9j7ExUb+xiPp/sZudb7ExUb+xMVG/sZuNX/GKvI/BIUGfMdvdn/IrfL/xcaIP8n1eb/J9Dh/xkcIf8ZGR7/J8/f/xxCSv8ZGyH/J9Dg/ybQ4P8ZHCL/FSQs/yPK3/8UExj/GE1b/ybS5P8ZGB7/Ghwj/ynW5P8p2Ob/Ghwi/yWrtv8p1eH/Ghwi/xocIv8p1uT/J8XT/xkcIv8m1un/Hb7d/xUYH/8hzOr/HtHu/xcaIf8XGB//I8vi/xgxOv8XGSD/I8rg/yPK4P8XGiD/GUFL/yPP6f8SERj/Fhkh/x3A4f8AAAAAJ2f9/ydr//8mZPH/AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAlYu38J2v//ydo/f8AAAAAAAAAAAd8/fkFqf//Iob8sAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAMY39awWr//8FfP3/AAAAAAAAAAAFm/7/SfD//wR+/f8AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAOB/f9B7v//BaX+/wAAAAAAAAAAQ878SAyZ/v9n1v4KAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAADu9v8DDJb+/z3N/XgAAAAA3/sAAN/7AADf+wAA3/sAAAAAAAAAAAAAAAAAAN/7AAAAAAAAAAAAAAAAAAAAAAAAj/EAAI/5AACP8QAA3/sAAA==" rel="icon" type="image/x-icon" />
diff --git a/template/post.html b/template/post.html
index 839444d..461480d 100755
--- a/template/post.html
+++ b/template/post.html
@@ -19,7 +19,7 @@
19 <header> 19 <header>
20 <h1 itemtype="headline">{{.Title}}</h1> 20 <h1 itemtype="headline">{{.Title}}</h1>
21 {{if .Listing}} 21 {{if .Listing}}
22 <time>Posted on {{.CreatedFormatted}}</time> 22 <time>Published on {{.CreatedFormatted}}</time>
23 {{end}} 23 {{end}}
24 </header> 24 </header>
25 <div> 25 <div>
@@ -31,11 +31,13 @@
31 31
32 <hr class="top-margin"> 32 <hr class="top-margin">
33 33
34 <p> 34 <p class="top-margin">
35 <strong>IRC:</strong> You can contact me on IRC <code>irc.libera.chat:6697</code> on channel <code>#mitjafelicijan</code>. 35 <strong>Comment, contact:</strong> You can contact me on IRC <code>irc.libera.chat:6697</code> on channel <code>#mitjafelicijan</code>.
36 Or by going to <a href="https://web.libera.chat/#mitjafelicijan" target="_blank">https://web.libera.chat/#mitjafelicijan</a>. 36 Or by going to <a href="https://web.libera.chat/#mitjafelicijan" target="_blank">https://web.libera.chat/#mitjafelicijan</a>.
37 </p> 37 </p>
38 38
39 <p>You can also just write me an email at m@mitjafelicijan.com</p>
40
39 <hr class="top-margin"> 41 <hr class="top-margin">
40 42
41 {{if .Posts}} 43 {{if .Posts}}
@@ -59,6 +61,7 @@
59 <hr class="top-margin"> 61 <hr class="top-margin">
60 62
61 {{template "openring-build.html"}} 63 {{template "openring-build.html"}}
64
62 {{end}} 65 {{end}}
63 66
64 </main> 67 </main>
diff --git a/template/style.css b/template/style.css
index 0aae48b..e24f25f 100755
--- a/template/style.css
+++ b/template/style.css
@@ -1,3 +1,5 @@
1@import url('https://fonts.googleapis.com/css2?family=IBM+Plex+Sans:wght@300;400;500;600;700&display=swap');
2
1:root { 3:root {
2 --base-document-width: 640px; 4 --base-document-width: 640px;
3 --base-font-size: 16px; 5 --base-font-size: 16px;
@@ -25,7 +27,8 @@
25 27
26body { 28body {
27 background: white; 29 background: white;
28 font-family: 'Times New Roman', Times, serif; 30 /*font-family: 'Times New Roman', Times, serif;*/
31 font-family: 'IBM Plex Sans', sans-serif;
29 color: var(--base-color); 32 color: var(--base-color);
30 font-size: var(--base-font-size); 33 font-size: var(--base-font-size);
31 line-height: var(--base-line-heigh); 34 line-height: var(--base-line-heigh);
@@ -59,9 +62,13 @@ hr {
59 62
60/* links */ 63/* links */
61 64
62a {} 65a {
66 color: black;
67}
63 68
64a:hover {} 69a:hover {
70 background: rgb(255, 241, 177);
71}
65 72
66 73
67/* headings */ 74/* headings */
@@ -182,16 +189,18 @@ blockquote p {
182 font-size: 80%; 189 font-size: 80%;
183 font-weight: 500; 190 font-weight: 500;
184 line-height: 1.2em; 191 line-height: 1.2em;
192 color: #a7a7a7;
185} 193}
186 194
187.post-list li a { 195.post-list li a {
188 display: inline-block; 196 display: inline-block;
197 text-decoration: none;
189} 198}
190 199
191.post-list li a:hover {} 200.post-list li a:hover {}
192 201
193.post-list li a h2 { 202.post-list li a h2 {
194 font-weight: 500; 203 font-weight: 400;
195 font-size: 100%; 204 font-size: 100%;
196 margin: 0; 205 margin: 0;
197} 206}
@@ -392,11 +401,12 @@ audio {
392 .navigation header { display: block; } 401 .navigation header { display: block; }
393 .navigation header h3 { text-align: center; margin-bottom: 10px; } 402 .navigation header h3 { text-align: center; margin-bottom: 10px; }
394 .navigation header nav { text-align: center; } 403 .navigation header nav { text-align: center; }
404 .post-list li a h2 { font-weight: 500; }
395} 405}
396 406
397/* light/dark mode */ 407/* light/dark mode */
398 408
399@media (prefers-color-scheme: light) { } 409/*@media (prefers-color-scheme: light) { }
400 410
401@media (prefers-color-scheme: dark) { 411@media (prefers-color-scheme: dark) {
402 body { 412 body {
@@ -419,4 +429,4 @@ audio {
419 blockquote:before { 429 blockquote:before {
420 background-image: url('/assets/general/alert-dark.svg'); 430 background-image: url('/assets/general/alert-dark.svg');
421 } 431 }
422} 432}*/