Added new styles

6 files changed, 33 insertions, 24 deletions

diff --git a/Makefile b/Makefile
index 6e9acf0..d6b6c09 100644
--- a/Makefile
+++ b/Makefile
@@ -11,29 +11,24 @@ dither:
         bash tools/dither-images.sh
 
 openring:
-        openring -l 165 -n 4 -p 1 \
-                -s https://cronokirby.com/posts/index.xml \
+        mkdir -p public
+        openring -l 165 -n 5 -p 1 \
                 -s https://drewdevault.com/feed.xml \
                 -s https://danluu.com/atom.xml \
                 -s https://serokell.io/blog.rss.xml \
+                -s https://cronokirby.com/posts/index.xml \
+                -s https://www.jeffgeerling.com/blog.xml \
                 < template/openring.tmpl \
                 > template/openring-build.html
 
 dev: alternator server
 
 alternator: openring
+        mkdir -p public
         alternator --watch
 
-build:
+build: openring
         mkdir -p public
-        openring -l 165 -n 4 -p 1 \
-                -s https://cronokirby.com/posts/index.xml \
-                -s https://drewdevault.com/feed.xml \
-                -s https://danluu.com/atom.xml \
-                -s https://serokell.io/blog.rss.xml \
-                < template/openring.tmpl \
-                > template/openring-build.html
-
         alternator --build
         rm template/openring-build.html
 
diff --git a/assets/general/favicon.ico b/assets/general/favicon.ico
new file mode 100644
index 0000000..c6b2ff4
--- /dev/null
+++ b/assets/general/favicon.ico
diff --git a/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md b/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md
index fdbdf5b..4910bb3 100644
--- a/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md
+++ b/posts/2019-01-03-encoding-binary-data-into-dna-sequence.md
@@ -147,7 +147,7 @@ In bioinformatics, FASTA format is a text-based format for representing either n
 
 The first line in a FASTA file started either with a ">" (greater-than) symbol or, less frequently, a ";" (semicolon) was taken as a comment. Subsequent lines starting with a semicolon would be ignored by software. Since the only comment used was the first, it quickly became used to hold a summary description of the sequence, often starting with a unique library accession number, and with time it has become commonplace to always use ">" for the first line and to not use ";" comments (which would otherwise be ignored).
 
-```text
+```
 ;LCBO - Prolactin precursor - Bovine
 ; a sample sequence in FASTA format
 MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSS
@@ -220,7 +220,7 @@ First we encode text file into FASTA file.
 
 Output of `quote.fa` file contains the encoded DNA sequence in ASCII format.
 
-```text
+```
 >SEQ1
 GACAGCTTGTGTACAAGTGTGCTTGCTCGCGAGCGGGTACGCGCGTGGGCTAACAAGTGA
 GCCAGCAGGTGAACAAGTGTGCGGACAAGCCAGCAGGTGCGCGGACAAGCTGGCGGGTGA
diff --git a/template/_meta.html b/template/_meta.html
index 23275a0..73a33d0 100755
--- a/template/_meta.html
+++ b/template/_meta.html
@@ -5,10 +5,11 @@
 
 <meta name="theme-color" content="#ffffff">
 
-<link rel="stylesheet" href="/style.css?v=2022-06-11-00">
+<link rel="stylesheet" href="/style.css?v=2022-06-28-4">
 
 <link rel="alternate" type="application/rss+xml" href="/feed.rss">
 <link rel="alternate" type="application/feed+json" href="/feed.json">
 <link rel="alternate" type="application/rss+xml" href="/yapyap.xml" title="YapYap">
 
-<link rel="icon" href="/assets/general/favicon.png?v=2021-12-07-1" type="image/png">
+<!--<link rel="icon" href="/assets/general/favicon.png?v=2021-12-07-1" type="image/png">-->
+<link href="data:image/x-icon;base64,AAABAAEAEBAAAAEAIABoBAAAFgAAACgAAAAQAAAAIAAAAAEAIAAAAAAAAAQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAL69vf8AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAv76+/8LBwQkAAAAAAAAAAAAAAAC+vb3/AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAL+9vf/Bv78JAAAAAAAAAAAAAAAAu7q6/wAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAC7ubr/vr29CAAAAAAAAAAAy8nJAZ6foP8AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAnqGj/6GipAoAAAAAHLjU/xcXHf/BwsL/I8XY/yPK3v8XGiD/IbjL/yPF2f8XGiD/Fxkf/yLF2f8gnK3/Fxog/62ztv8fwNf/FRcd/x271v8mz93/GRsi/xkXHf8p097/GiIp/xobIv8p0t3/KdPe/xocIv8fYmr/KNPe/xoZH/8aHCL/J87c/xy81/8VFxz/IsPZ/8zS0/8XGiD/Ir/R/yPH2/8XGiD/Fxkf/yPH2/8dd4T/GBog/yPJ3f8jyNr/uru9/xcUGv8cudb/EhITDKi5vRKlvMP/RUpOERwcHRAdOj4QHTk8EBwdHRAdNTgQHTo/EBwcHRAcHB0QSGduEKW4vf+koqQfHzg+EBqz0ewSFRv7EyMr/xq51vsTERb7ExUb+xq41fsau9j7ExUb+xiPp/sZudb7ExUb+xMVG/sZuNX/GKvI/BIUGfMdvdn/IrfL/xcaIP8n1eb/J9Dh/xkcIf8ZGR7/J8/f/xxCSv8ZGyH/J9Dg/ybQ4P8ZHCL/FSQs/yPK3/8UExj/GE1b/ybS5P8ZGB7/Ghwj/ynW5P8p2Ob/Ghwi/yWrtv8p1eH/Ghwi/xocIv8p1uT/J8XT/xkcIv8m1un/Hb7d/xUYH/8hzOr/HtHu/xcaIf8XGB//I8vi/xgxOv8XGSD/I8rg/yPK4P8XGiD/GUFL/yPP6f8SERj/Fhkh/x3A4f8AAAAAJ2f9/ydr//8mZPH/AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAlYu38J2v//ydo/f8AAAAAAAAAAAd8/fkFqf//Iob8sAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAMY39awWr//8FfP3/AAAAAAAAAAAFm/7/SfD//wR+/f8AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAOB/f9B7v//BaX+/wAAAAAAAAAAQ878SAyZ/v9n1v4KAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAADu9v8DDJb+/z3N/XgAAAAA3/sAAN/7AADf+wAA3/sAAAAAAAAAAAAAAAAAAN/7AAAAAAAAAAAAAAAAAAAAAAAAj/EAAI/5AACP8QAA3/sAAA==" rel="icon" type="image/x-icon" />
diff --git a/template/post.html b/template/post.html
index 839444d..461480d 100755
--- a/template/post.html
+++ b/template/post.html
@@ -19,7 +19,7 @@
         <header>
           <h1 itemtype="headline">{{.Title}}</h1>
           {{if .Listing}}
-          <time>Posted on {{.CreatedFormatted}}</time>
+          <time>Published on {{.CreatedFormatted}}</time>
           {{end}}
         </header>
         <div>
@@ -31,11 +31,13 @@
 
       <hr class="top-margin">
 
-      <p>
-        <strong>IRC:</strong> You can contact me on IRC <code>irc.libera.chat:6697</code> on channel <code>#mitjafelicijan</code>.
+      <p class="top-margin">
+        <strong>Comment, contact:</strong> You can contact me on IRC <code>irc.libera.chat:6697</code> on channel <code>#mitjafelicijan</code>.
         Or by going to <a href="https://web.libera.chat/#mitjafelicijan" target="_blank">https://web.libera.chat/#mitjafelicijan</a>.
       </p>
 
+      <p>You can also just write me an email at m@mitjafelicijan.com</p>
+
       <hr class="top-margin">
 
       {{if .Posts}}
@@ -59,6 +61,7 @@
       <hr class="top-margin">
 
       {{template "openring-build.html"}}
+
       {{end}}
 
     </main>
diff --git a/template/style.css b/template/style.css
index 0aae48b..e24f25f 100755
--- a/template/style.css
+++ b/template/style.css
@@ -1,3 +1,5 @@
+@import url('https://fonts.googleapis.com/css2?family=IBM+Plex+Sans:wght@300;400;500;600;700&display=swap');
+
 :root {
   --base-document-width: 640px;
   --base-font-size: 16px;
@@ -25,7 +27,8 @@
 
 body {
   background: white;
-  font-family: 'Times New Roman', Times, serif;
+  /*font-family: 'Times New Roman', Times, serif;*/
+  font-family: 'IBM Plex Sans', sans-serif;
   color: var(--base-color);
   font-size: var(--base-font-size);
   line-height: var(--base-line-heigh);
@@ -59,9 +62,13 @@ hr {
 
 /* links */
 
-a {}
+a {
+  color: black;
+}
 
-a:hover {}
+a:hover {
+  background: rgb(255, 241, 177);
+}
 
 
 /* headings */
@@ -182,16 +189,18 @@ blockquote p {
   font-size: 80%;
   font-weight: 500;
   line-height: 1.2em;
+  color: #a7a7a7;
 }
 
 .post-list li a {
   display: inline-block;
+  text-decoration: none;
 }
 
 .post-list li a:hover {}
 
 .post-list li a h2 {
-  font-weight: 500;
+  font-weight: 400;
   font-size: 100%;
   margin: 0;
 }
@@ -392,11 +401,12 @@ audio {
   .navigation header { display: block; }
   .navigation header h3 { text-align: center; margin-bottom: 10px; }
   .navigation header nav { text-align: center; }
+  .post-list li a h2 { font-weight: 500; }
 }
 
 /* light/dark mode */
 
-@media (prefers-color-scheme: light) { }
+/*@media (prefers-color-scheme: light) { }
 
 @media (prefers-color-scheme: dark) {
   body {
@@ -419,4 +429,4 @@ audio {
   blockquote:before {
     background-image: url('/assets/general/alert-dark.svg');
   }
-}
+}*/